Antibodies

View as table Download

Rabbit Polyclonal Anti-GJB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Rabbit Polyclonal Anti-GJB4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJB4