GJB4 Rabbit Polyclonal Antibody

CAT#: TA341676

Rabbit Polyclonal Anti-GJB4 Antibody

Product Images

WB Suggested Anti-GJB4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: gap junction protein beta 4
• Database Link:
  NP_694944
  Entrez Gene 127534 Human
  UniProt ID Q9NTQ9
• Background: This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations inThis gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
• Synonyms: CX30.3; EKV
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Mouse: 86%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane