Antibodies

Jump to Filters
View as table Download
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA335806

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA350295

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA358331

USD 360.00

5 Days

PPP2CA Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated