Antibodies

Jump to Filters
View as table Download
RPS23 Rabbit Polyclonal Antibody
TA314496

USD 345.00

4 Weeks

Rabbit polyclonal anti-RPS23 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RPS23.
Rps23 Rabbit Polyclonal Antibody
TA337937

USD 375.00

5 Days

Rabbit Polyclonal Anti-Rps23 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rps23 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rps23. Synthetic peptide located within the following region: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS