Rps23 Rabbit Polyclonal Antibody

CAT#: TA337937

Rabbit Polyclonal Anti-Rps23 Antibody

Product Images

Host: Rabbit; Target Name: Rps23; Sample Tissue: Rat Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rps23 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rps23. Synthetic peptide located within the following region: SHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: ribosomal protein S23
• Database Link:
  NP_511172
  Entrez Gene 124323 Rat
  UniProt ID P62268
• Background: Rps23 is a 40S ribosomal subunit protein.
• Synonyms: FLJ35016
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%