ALOX15 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALOX15 |
ALOX15 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALOX15 |
Rabbit polyclonal Anti-ALOX15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALOX15 antibody: synthetic peptide directed towards the middle region of human ALOX15. Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
Rabbit anti 15-Lox-1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ALOX15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALOX15 |