Germany
Japan
United Kingdom
China
ALOX15 Rabbit Polyclonal Antibody
Product Images
Other products for "ALOX15"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ALOX15 antibody: synthetic peptide directed towards the middle region of human ALOX15. Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 73 kDa |
| Gene Name | arachidonate 15-lipoxygenase |
| Database Link | |
| Background | ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid. |
| Synonyms | 12-LOX; 15-LOX-1; 15LOX-1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 92%; Rat: 85%; Mouse: 85% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.