Antibodies

View as table Download

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Rabbit Polyclonal Anti-HK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2