Hexokinase II (HK2) Rabbit Polyclonal Antibody

CAT#: TA336240

Rabbit Polyclonal Anti-HK2 Antibody

Product Images

Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Gene Name: HK2; Submitted by: Received from annonymous;

• 

  WB Suggested Anti-HK2 Antibody Titration: 1 ug/ml; Positive Control: 721_B cell lysateHK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HK2 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: hexokinase 2
• Database Link:
  NP_000180
  Entrez Gene 3099 Human
  UniProt ID P52789
• Background: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-348 AI278414.1 4-351 349-732 CB160837.1 11-394 c 733-1006 BM912287.1 1-274 c 1007-1333 AI085541.1 1-327 c 1334-1477 AW134604.1 8-151 1478-4058 AF148513.1 1-2581 4059-5498 BC064369.1 2575-4014 5499-5615 BM706373.1 303-419 5616-7109 BC064369.1 4130-5623
• Synonyms: HKII; HXK2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus