Antibodies

View as table Download

Rabbit Polyclonal Antibody against ABCE1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-119 of the ABCE1 protein.

Rabbit Polyclonal Anti-ABCE1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCE1 Antibody: synthetic peptide directed towards the C terminal of human ABCE1. Synthetic peptide located within the following region: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Anti-ABCE1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1

Anti-ABCE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 345-562 amino acids of human ATP-binding cassette, sub-family E (OABP), member 1