Rabbit polyclonal Anti-Aquaporin 5
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DHREERKKTIELTAH corresponding to amino acid residues 251-265 of rat AQP5? ?. Intracellular, C-terminus.? ? |
Rabbit polyclonal Anti-Aquaporin 5
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DHREERKKTIELTAH corresponding to amino acid residues 251-265 of rat AQP5? ?. Intracellular, C-terminus.? ? |
Rabbit Polyclonal Anti-AQP5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AQP5 Antibody is: synthetic peptide directed towards the C-terminal region of Human AQP5. Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE |
Anti-AQP5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 250-265 amino acids of Human aquaporin 5 |
Anti-AQP5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 250-265 amino acids of Human Aquaporin-5 |
AQP5 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AQP5 (NP_001642.1). |
Modifications | Unmodified |
AQP5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AQP5 (NP_001642.1). |
Modifications | Unmodified |