Aquaporin 5 (AQP5) Rabbit Polyclonal Antibody

CAT#: TA335862

Rabbit Polyclonal Anti-AQP5 Antibody

Product Images

Host: Rabbit; Target Name: AQP5; Sample Tissue: COLO205 Whole cell lysates; Antibody Dilution: 1.0 ug/ml. AQP5 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AQP5 Antibody is: synthetic peptide directed towards the C-terminal region of Human AQP5. Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: aquaporin 5
• Database Link:
  NP_001642
  Entrez Gene 362 Human
  UniProt ID P55064
• Background: Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.
• Synonyms: AQP-5; PPKB
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Sheep: 86%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane