Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal BCAP31 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This BCAP31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-147 amino acids from the Central region of human BCAP31. |
Rabbit Polyclonal Anti-BCAP31 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCAP31 antibody: synthetic peptide directed towards the middle region of human BCAP31. Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
BCAP31 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BCAP31 |
BCAP31 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BCAP31 |
BCAP31 Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BCAP31 |
BAP31 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- BCAP31
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated