Antibodies

Jump to Filters
View as table Download
CITED4 Rabbit Monoclonal Antibody [Clone ID: EPR2702]
TA307013

USD 432.00

In Stock

Rabbit monoclonal antibody against CITED4(clone EPR2702)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CITED4 Rabbit Polyclonal Antibody
TA372243

USD 380.00

4 Weeks

CITED4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CITED4
Cited4 Rabbit Polyclonal Antibody
TA342331

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cited4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA
Cited4 Rabbit Polyclonal Antibody
TA342332

USD 310.00

5 Days

Rabbit Polyclonal Anti-CITED4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED4 antibody: synthetic peptide directed towards the N terminal of mouse CITED4. Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG