Cited4 Rabbit Polyclonal Antibody

CAT#: TA342332

Rabbit Polyclonal Anti-CITED4 Antibody

Product Images

WB Suggested Anti-CITED4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CITED4 antibody: synthetic peptide directed towards the N terminal of mouse CITED4. Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4
• Database Link:
  NP_062509
  Entrez Gene 56222 Mouse
  UniProt ID Q9WUL8
• Background: Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription.
• Synonyms: MRG-2; MRG2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%