Antibodies

Jump to Filters
View as table Download
CREM Rabbit Polyclonal Antibody
TA332796

USD 275.00

3 Weeks

Rabbit anti-CREM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CREM
CREM Rabbit Polyclonal Antibody
TA312509

USD 345.00

In Stock

Rabbit polyclonal anti-CREM antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CREM.
CREM Rabbit Polyclonal Antibody
TA337721

USD 310.00

5 Days

Rabbit Polyclonal Anti-CREM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREM antibody: synthetic peptide directed towards the N terminal of human CREM. Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR
CREM Rabbit Polyclonal Antibody
TA337722

USD 375.00

5 Days

Rabbit Polyclonal Anti-Crem Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Crem antibody is: synthetic peptide directed towards the C-terminal region of Rat Crem. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE