Antibodies

Jump to Filters
View as table Download
RBJ (DNAJC27) Rabbit Polyclonal Antibody
TA345012

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBJ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBJ antibody: synthetic peptide directed towards the middle region of human RBJ. Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR
Dnajc27 Rabbit Polyclonal Antibody
TA357344

USD 360.00

5 Days

Dnajc27 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated