RBJ (DNAJC27) Rabbit Polyclonal Antibody

CAT#: TA345012

Rabbit Polyclonal Anti-RBJ Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27)
    • 20 ug

USD 823.00


Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "DNAJC27"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RBJ antibody: synthetic peptide directed towards the middle region of human RBJ. Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name DnaJ heat shock protein family (Hsp40) member C27
Background The exact function of this protein remains unknown.
Synonyms RabJS; RBJ
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.