RBJ (DNAJC27) Rabbit Polyclonal Antibody

CAT#: TA345012

Rabbit Polyclonal Anti-RBJ Antibody - middle region

Product Images

WB Suggested Anti-RBJ Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBJ antibody: synthetic peptide directed towards the middle region of human RBJ. Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C27
• Database Link:
  NP_057628
  Entrez Gene 51277 Human
  UniProt ID Q9NZQ0
• Background: The exact function of this protein remains unknown.
• Synonyms: RabJS; RBJ
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 79%