RBJ (DNAJC27) (NM_016544) Human Recombinant Protein

CAT#: TP305500

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 27 (DNAJC27)

Product Images

Coomassie blue staining of purified DNAJC27 protein (Cat# TP305500). The protein was produced from HEK293T cells transfected with DNAJC27 cDNA clone (Cat# RC205500) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205500 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF
  DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK
  HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR
  RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057628
• Locus ID: 51277
• UniProt ID: Q9NZQ0
• Cytogenetics: 2p23.3
• Refseq Size: 5008
• Refseq ORF: 819
• Synonyms: RabJS; RBJ
• Summary: GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling.[UniProtKB/Swiss-Prot Function]