RBJ (DNAJC27) (NM_016544) Human Mass Spec Standard

CAT#: PH305500

DNAJC27 MS Standard C13 and N15-labeled recombinant protein (NP_057628)

Product Images

Coomassie blue staining of purified DNAJC27 protein (Cat# TP305500). The protein was produced from HEK293T cells transfected with DNAJC27 cDNA clone (Cat# RC205500) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205500
• Predicted MW: 30.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205500 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF
  DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK
  HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR
  RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057628
• RefSeq Size: 5008
• RefSeq ORF: 819
• Synonyms: RabJS; RBJ
• Locus ID: 51277
• UniProt ID: Q9NZQ0
• Cytogenetics: 2p23.3
• Summary: GTPase which can activate the MEK/ERK pathway and induce cell transformation when overexpressed. May act as a nuclear scaffold for MAPK1, probably by association with MAPK1 nuclear export signal leading to enhanced ERK1/ERK2 signaling. [UniProtKB/Swiss-Prot Function]