Antibodies

View as table Download

Rabbit Polyclonal Anti-ILF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE

Rabbit Polyclonal Anti-Ilf2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ilf2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Ilf2. Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY

Rabbit Polyclonal Anti-ILF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ILF2 antibody is: synthetic peptide directed towards the N-terminal region of Human ILF2. Synthetic peptide located within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV

ILF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2).
Modifications Unmodified

ILF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2).
Modifications Unmodified