ILF2 Rabbit Polyclonal Antibody

CAT#: TA339093

Rabbit Polyclonal Anti-ILF2 Antibody

Product Images

WB Suggested Anti-ILF2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: ILF2; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

• 

  Sample Type: MCF-7 WT a whole cell lysates (110UG); Primary Dilution: 1.5mg/mL ; Secondary Antibody: LI-COR Donkey anti-rabbit; Secondary Dilution: 1:10,000; ; ILF2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Human kidney

• 

  Rabbit Anti-ILF2 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: interleukin enhancer binding factor 2
• Database Link:
  NP_004506
  Entrez Gene 3608 Human
  UniProt ID Q12905
• Background: The protein encoded by this gene is the 45 kDa component of nuclear factor of activated T-cells (NFAT), a heterodimer of 45 kDa and 90 kDa proteins. NFAT is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The complex has been shown to repair DNA breaks by nonhomologous end joining and can also negatively regulate the microRNA processing pathway. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Jun 2012]
• Synonyms: NF45; PRO3063
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors