Antibodies

View as table Download

Rabbit Polyclonal Kv1.2 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142]

Rabbit Polyclonal Kv1.2 Antibody

Applications IF
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142]

Rabbit polyclonal Anti-KV1.2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2.Intracellular, C-terminus.

Rabbit Polyclonal Kv1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu
Conjugation Unconjugated
Immunogen Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family.

KCNA2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2

KCNA2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA2

KCNA2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human KCNA2 (NP_001191198.1).
Modifications Unmodified