Antibodies

View as table Download

Rabbit Polyclonal Anti-MED16 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED16 antibody is: synthetic peptide directed towards the middle region of Human MED16. Synthetic peptide located within the following region: IVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWI

Rabbit Polyclonal Anti-MED16 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED16 antibody: synthetic peptide directed towards the C terminal of human MED16. Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Rabbit Polyclonal Anti-THRAP5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-THRAP5 antibody: synthetic peptide directed towards the C terminal of human THRAP5. Synthetic peptide located within the following region: RLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKAC

Rabbit Polyclonal anti-MED16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED16 antibody: synthetic peptide directed towards the N terminal of human MED16. Synthetic peptide located within the following region: FGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAF

Rabbit Polyclonal Anti-MED16 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MED16

MED16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MED16