Antibodies

View as table Download

Rabbit Polyclonal Anti-Melk Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Melk antibody is: synthetic peptide directed towards the N-terminal region of Mouse Melk. Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC

Rabbit Polyclonal Anti-MELK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK

MELK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MELK

MELK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1).
Modifications Unmodified