Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the N terminal of human MSI2. Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM |
Rabbit Polyclonal Anti-MSI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the middle region of human MSI2. Synthetic peptide located within the following region: YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI |
MSI2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MSI2 |
Germany
Japan
United Kingdom
China
