MSI2 Rabbit Polyclonal Antibody

CAT#: TA344017

Rabbit Polyclonal Anti-MSI2 Antibody

Product Images

WB Suggested Anti-MSI2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSI2 antibody: synthetic peptide directed towards the middle region of human MSI2. Synthetic peptide located within the following region: YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: musashi RNA binding protein 2
• Database Link:
  NP_733839
  Entrez Gene 124540 Human
  UniProt ID Q96DH6
• Background: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.
• Synonyms: MSI2H
• Note: Immunogen Sequence Homology: Human: 100%