Antibodies

Jump to Filters
View as table Download
PLRG1 Rabbit Polyclonal Antibody
TA332120

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP
PLRG1 Rabbit Polyclonal Antibody
TA380058

USD 220.00

3 Weeks

PLRG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PLRG1 (NP_001188493.1).
Modifications Unmodified