PLRG1 Rabbit Polyclonal Antibody

CAT#: TA332120

Rabbit Polyclonal Anti-PLRG1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PLRG1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name pleiotropic regulator 1
Background PLRG1 is necessary for spliceosome assembly and for pre-mRNA splicing.
Synonyms Cwc1; PRL1; PRP46; PRPF46; TANGO4
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Horse: 92%; Bovine: 85%; Dog: 83%
Reference Data
Protein Families Transcription Factors
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.