Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against PLRG1
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PVSWKPEIIKRKRF, from the C Terminus of the protein sequence according to NP_002660.1. |
Antibodies
View as table Download
PLRG1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 16-45 amino acids from the N-terminal region of Human PLRG1 |
Rabbit Polyclonal Anti-PLRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP |
PLRG1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PLRG1 (NP_001188493.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PLRG1