Antibodies

Jump to Filters
View as table Download
RNF39 Rabbit Polyclonal Antibody
TA590377

USD 409.00

In Stock

Rabbit Polyclonal RNF39 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
RNF39 Rabbit Polyclonal Antibody
TA330475

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF39 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the N terminal of human RNF39. Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
RNF39 Rabbit Polyclonal Antibody
TA330522

USD 310.00

5 Days

Rabbit Polyclonal Anti-RNF39 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the C terminal of human RNF39. Synthetic peptide located within the following region: CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL