RNF39 Rabbit Polyclonal Antibody

CAT#: TA330475

Rabbit Polyclonal Anti-RNF39 Antibody

Product Images

WB Suggested Anti-RNF39 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the N terminal of human RNF39. Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ring finger protein 39
• Database Link:
  NP_079512
  Entrez Gene 80352 Human
  UniProt ID Q9H2S5
• Background: Its gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that RNF39 plays a role in an early phase of synaptic plasticity. Its gene lies within the major histocompatibility complex class I region on chromosome 6.This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Alternative splicing results in three transcript variants encoding different isoforms.
• Synonyms: HZF; HZFW; LIRF
• Note: Immunogen sequence homology: Human: 100%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome