Antibodies

View as table Download

Rabbit Polyclonal Anti-Neuroserpin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Neuroserpin Antibody: Peptide sequence around aa.402~406(T-S-G-H-D) derived from Human Neuroserpin.

Anti-SERPINI1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.402~406(T-S-G-H-D) derived from Human Neuroserpin.

Anti-Human Neuroserpin Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Neuroserpin

Biotinylated Anti-Human Neuroserpin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Neuroserpin

Rabbit polyclonal Anti-SERPINI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINI1 antibody: synthetic peptide directed towards the middle region of human SERPINI1. Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

SERPINI1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 181-410 of human SERPINI1 (NP_005016.1).
Modifications Unmodified