Neuroserpin (SERPINI1) Rabbit Polyclonal Antibody

CAT#: TA342233

Rabbit polyclonal Anti-SERPINI1 Antibody

Product Images

WB Suggested Anti-SERPINI1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINI1 antibody: synthetic peptide directed towards the middle region of human SERPINI1. Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: serpin family I member 1
• Database Link:
  NP_005016
  Entrez Gene 5274 Human
  UniProt ID Q99574
• Background: This gene encodes a member ofThe serpin superfamily of serine proteinase inhibitors.The protein is primarily secreted by axons inThe brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role inThe regulation of axonal growth andThe development of synaptic plasticity. Mutations inThis gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized byThe accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encodingThe same protein, have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: neuroserpin; PI12
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein