Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Neuroserpin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuroserpin Antibody: Peptide sequence around aa.402~406(T-S-G-H-D) derived from Human Neuroserpin. |
Antibodies
View as table Download
Anti-SERPINI1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.402~406(T-S-G-H-D) derived from Human Neuroserpin. |
Goat Polyclonal Antibody against SERPINI1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TMNTSGHDFEEL, from the C Terminus of the protein sequence according to NP_005016.1. |
Biotinylated Anti-Human Neuroserpin Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Neuroserpin |
Rabbit polyclonal Anti-SERPINI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINI1 antibody: synthetic peptide directed towards the middle region of human SERPINI1. Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF |
Carrier-free (BSA/glycerol-free) SERPINI1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SERPINI1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 181-410 of human SERPINI1 (NP_005016.1). |
| Modifications | Unmodified |
SERPINI1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINI1 mouse monoclonal antibody,clone OTI1A5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINI1 mouse monoclonal antibody,clone OTI1A5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SERPINI1 mouse monoclonal antibody,clone OTI1A5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SERPINI1