Rabbit Polyclonal Anti-SOX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS |
Rabbit Polyclonal Anti-SOX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the N terminal of human SOX15. Synthetic peptide located within the following region: MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVK |
Rabbit Polyclonal Anti-SOX15 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the N terminal of human SOX15. Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR |
Rabbit polyclonal SOX15 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SOX15 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-125 amino acids from the Central region of human SOX15. |
Rabbit Polyclonal Anti-SOX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX15 Antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: SHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMP |
SOX15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SOX15. |
Germany
Japan
United Kingdom
China
