Antibodies

Jump to Filters
View as table Download
TFPI2 Rabbit Polyclonal Antibody
TA344403

USD 475.00

5 Days

Rabbit Polyclonal Anti-TFPI2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
TFPI2 Rabbit Polyclonal Antibody
TA324268

USD 345.00

In Stock

Anti-TFPI2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2
TFPI2 Rabbit Polyclonal Antibody
TA324269

USD 345.00

In Stock

Anti-TFPI2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-235 amino acids of human tissue factor pathway inhibitor 2