TFPI2 Rabbit Polyclonal Antibody

CAT#: TA344403

Rabbit Polyclonal Anti-TFPI2 Antibody - middle region

Product Images

WB Suggested Anti-TFPI2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

• 

  Sample Type: Human Macrophange Cells; Green: primary; Red: phallodin; Blue: DAPI; Yellow: green/red; Primary; Dilution: 1:200; Secondary Antibody: anti-Rabbit IgG-FITC; Secondary; Dilution: 1:1000; Image Submitted By: Milan Fiala; University of California

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: tissue factor pathway inhibitor 2
• Database Link:
  NP_006519
  Entrez Gene 7980 Human
  UniProt ID P48307
• Background: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
• Synonyms: PP5; REF1; TFPI-2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein