Rabbit Polyclonal Anti-C10orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
Recombinant Anti-PD-1H (Clone MH5A)
| Applications | ELISA, IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-PD-1H (Clone mam82)
| Applications | ELISA, IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-VISTA (Clone 13F3)
| Applications | Bl, ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China