Antibodies

Jump to Filters
View as table Download
ABCA1 Rabbit Polyclonal Antibody
TA310028

USD 205.00

3 Weeks

Rabbit anti-ABCA1 polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA1.
ABCA1 Rabbit Polyclonal Antibody
TA322600

USD 345.00

4 Weeks

Anti-ABCA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1.
ABCA1 Rabbit Polyclonal Antibody
TA332061

USD 375.00

5 Days

Rabbit Polyclonal Anti-Abca1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK