Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A3