SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

CAT#: TA339001

Rabbit Polyclonal Anti-ATP2A3 Antibody

Product Images

Host: Rabbit; Target Name: ATP2A3; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.ATP2A3 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  WB Suggested Anti-ATP2A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate.ATP2A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 109 kDa
• Gene Name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
• Database Link:
  NP_005164
  Entrez Gene 489 Human
  UniProt ID Q93084
• Background: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: SERCA3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway