Antibodies

View as table Download

Rabbit Polyclonal ABCA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information.

Rabbit anti-ABCA1 polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA1.

Anti-ABCA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1.

Rabbit Polyclonal Anti-Abca1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK