AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2 |
AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2 |
Rabbit Polyclonal Anti-AIFM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
Rabbit Polyclonal AMID Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to residues 170-185 [VTLIHSQVALADKELL] of the 41 kDa human PRG3 protein. This sequence is 87% identical in mouse. |
Rabbit polyclonal anti-AIFM2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM2. |