Rabbit Polyclonal Anti-BAZ1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAZ1B antibody: synthetic peptide directed towards the middle region of human BAZ1B. Synthetic peptide located within the following region: EQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQK |
Rabbit polyclonal anti-Williams Syndrome Transcription Factor (WSTF) antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Williams Syndrome Transcription Factor (WSTF) |
Rabbit Polyclonal Anti-BAZ1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BAZ1B |
Rabbit Polyclonal anti-BAZ1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BAZ1B |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
