Antibodies

Jump to Filters
View as table Download
GPR35 Rabbit Polyclonal Antibody
TA313953

USD 345.00

4 Weeks

Rabbit polyclonal anti-GPR35 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR35.
GPR35 Rabbit Polyclonal Antibody
TA340416

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPR35 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR35 antibody was raised against synthetic 18 amino acid peptide from 3rd extracellular domain of human GPR35. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (83%).
GPR35 Rabbit Polyclonal Antibody
TA338286

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: YITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTL
GPR35 Rabbit Polyclonal Antibody
TA338287

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR