Antibodies

Jump to Filters
View as table Download
LMO2 Rabbit Monoclonal Antibody [Clone ID: EP3257]
TA307207

USD 509.00

In Stock

Rabbit monoclonal antibody against LMO2(clone EP3257)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LMO2 Rabbit Polyclonal Antibody
TA336557

USD 457.00

5 Days

Rabbit Polyclonal LMO2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human LMO2 protein (within residues 1-100). [Swiss-Prot# P25791]
LMO2 Rabbit Polyclonal Antibody
TA329191

USD 375.00

5 Days

Rabbit Polyclonal anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS
LMO2 Rabbit Polyclonal Antibody
TA330149

USD 375.00

5 Days

Rabbit Polyclonal Anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE