LMO2 Rabbit Polyclonal Antibody

CAT#: TA330149

Rabbit Polyclonal Anti-LMO2 Antibody

Product Images

WB Suggested Anti-LMO2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: LIM domain only 2
• Database Link:
  NP_005565
  Entrez Gene 4005 Human
  UniProt ID P25791
• Background: LMO2 acts with TAL1/SCL to regulate red blood cell development. LMO2 also acts with LDB1 to maintain erythroid precursors in an immature state.LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: RBTN2; RBTNL1; RHOM2; TTG2
• Note: Immunogen sequence homology: Chicken: 100%; Dog: 100%; Guinea pig: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

Reference Data

• Protein Families: Druggable Genome