Antibodies

Jump to Filters
View as table Download
Bile Acid Receptor (NR1H4) Rabbit Polyclonal Antibody
TA334218

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1H4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT
Bile Acid Receptor (NR1H4) Rabbit Polyclonal Antibody
TA338165

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1H4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI
Bile Acid Receptor (NR1H4) Rabbit Polyclonal Antibody
TA309773

USD 424.00

5 Days

Rabbit Polyclonal FXR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminus of the human FXR protein.