PMPCA (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 461-490 amino acids from the C-terminal region of human PMPCA |
PMPCA (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 461-490 amino acids from the C-terminal region of human PMPCA |
Rabbit Polyclonal Anti-PMPCA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP |